PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn185011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 574aa    MW: 63403.7 Da    PI: 6.6408
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn185011genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.91.3e-24195248154
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                 k rl+W++eLH++Fv+a+eqLGG   A+Pk+ile+m+v+gL++e+v+S LQk++
  Achn185011 195 KHRLVWSKELHNKFVDALEQLGGGSTAVPKKILEVMDVPGLSRENVASNLQKFK 248
                 68**************************************************97 PP

2Response_reg70.47.4e-24301381109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+ + ++l+ ++l k +y +v+++++++eal++l++++  +Dl+++D+em +md ++ll+ i  e  ++p+i+++a+++ e + + ++ Ga 
    Achn185011  30 VLAVDDNLVCLKLIVTLLVKCRY-KVTATTKPTEALDMLRKNKesYDLVITDVEMLDMDSFQLLQIIGIEM-DVPVIMISANDDTESVMKGVRHGAL 124
                   799********************.***************888889********************996544.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   ++l+Kp+ +eel +
    Achn185011 125 EYLVKPVRIEELKN 138
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521729.11E-3226151IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.4E-3727165No hitNo description
SMARTSM004481.1E-2528140IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011039.21729144IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.5E-1930138IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.47E-2531143No hitNo description
PROSITE profilePS512949.555192252IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-23193252IPR009057Homeodomain-like
SuperFamilySSF466891.22E-14193253IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-20195248IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MMSENDQDLA NPNPNLESNA KTEFPEGLRV LAVDDNLVCL KLIVTLLVKC RYKVTATTKP  60
TEALDMLRKN KESYDLVITD VEMLDMDSFQ LLQIIGIEMD VPVIMISAND DTESVMKGVR  120
HGALEYLVKP VRIEELKNIW QHVVRKKLFE QAKSGTRKAT TDQNPMPSKR QRDKGKEKEE  180
ETKGPSDGES SATRKHRLVW SKELHNKFVD ALEQLGGGST AVPKKILEVM DVPGLSRENV  240
ASNLQKFKNL LKKDSQKSEM NLESENNIDS SNPNRHISDI TTLPYNNLGL NNIGNPGMAA  300
SFGNRNQTFS AYLANRRPLY QKCLLVPQVA DQVCPNVQNP VFGSLLPSPI PTWNPFPRPE  360
LNGMRLHSHV PRSFTAGQTS PSTMPLGLVP YSRPPDPLNL VQMLGDGSTQ LSRISQPDPL  420
AMMVPSSSQG QNERRNLVNF NGRGETSGFT FEMRGQIKVE STQNGQFVQN QPSENTQTET  480
NGNYNNCSSP DDDLSAMIRQ FSNNGPPSFT AGQTSPSTMP LGLVPYSRPP DPLNLVQMLG  540
DGSTQLSRIS QPDPLAMVVP SSSQGTSFSY SFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-15191255164ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1548956
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.16e-73response regulator 12